McDonnell Genome Institute

Washington University

CircRNA

chr2|179124363|179149394|-|SESTD1|ENST00000428443.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9298

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

4

Peptide

QNLLQAALEFHGVAQDVFEK

Amino Acids from 5' Exons

EWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQD,NGLQCMWNLISKLQHSMLAMRKILWNSHCSNNLVMFVIDRPVSWNLGKISYKQLLNFMVLPK,MVCSVCGTSANCSTLECWRGRSCGTKVTAATTCLLSTGQSAGIAKSLTSSSISWCCPR

Amino Acids from 3' Exons

VFEKFTKESTSLLDELALINNGSDKGNQQEKE,FLRSLQRNLHHYMNLLLTMEVIKEISKRKK,FEVYKGIYIIIRTCFDQWKRKSARERK