top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|171965337|171976308|+|HAT1|ENST00000264108.4

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

LMQGFNEDMVIEAQQK

Amino Acids from 5' Exons

ADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYK,QMMLRAKLDKSFHLDFAQTRMISFLYWKRKLISSHSEPYFIPTQFSVQQEEKTLPFRYI,RCGQNTNHSTWILHKHEFPFFTGKGSFQAIRNLTSYLLSSQSNRRRKLYLSDI

Amino Acids from 3' Exons

RKIHPKAMNYETLCLSFVKICPVFPGKNCKDSMKIWRHNRSSKI,GRSIQKLCEITRLCACEALSRFALFFPGKINARIQRYGDRGTTEVQNK,EDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINK

bottom of page