top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|169964392|170029448|+|UBR3|ENST00000430321.5

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9131

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

LTQLEEMNPHETK

Amino Acids from 5' Exons

DKTKTIFGINATYPEQIGWYCLEENGHLILGNWREGGKNGWR,ETKQKQFSEESIKQRTQSRLGGIALNKRMVTLSSEETGGKEERMDGDR,RQNKNNFLRNQLSNVPRADWVVLPIREWSPYPLRKLEGRRKEWMEIE

Amino Acids from 3' Exons

LFHVLALHMRLYSIDSEYNPWRKLTQLEEMNP,CFMYPCTCGFIALTLSIIPGESSPSKRIH,VSCISLAHAALHLVSLEKAHPVRRDEST

bottom of page