McDonnell Genome Institute

Washington University

CircRNA

chr2|169225309|169241365|-|LRP2|ENST00000263816.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.977

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

17

Peptide

TQSIEQPGLLVCATQMNFSAKK

Amino Acids from 5' Exons

GEIHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIE,VKFTERQMAPTGQYLLLYLWWGLLTWPIGFQETFILPILELSQS,NSQSEDRWHQQDSICFYIYGGAFYEPGLRLDFKKPLFYQSNSVNR

Amino Acids from 3' Exons

QPGLLVCATQMNFSAKKMVSASRTSGNVMGIQTASMDLMSTMPVSPRLALHHISTVTTETASTGHGSVIGTMTAGIVMRRTALLSPFAVLVGNGSVLAITSVIVCVMASLTAPMGQMSPHFA,NQASWYVPLRISVPRRWYLHPELLGMWASRLPLWIAQCLCPQDLPFIIFPLQRKLHPQGMALSGQLRGYEEGLPYSALSLSLAMAVSWPHLCESECSVWHLLPQWDRVPTL,TRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLC