McDonnell Genome Institute

Washington University

CircRNA

chr2|168873584|168877384|-|SPC25|ENST00000282074.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9823

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

DYEEISR

Amino Acids from 5' Exons

VRNCSLFSLILTLRILRAHLCFPYISMKQGTMK,EIAVYFHYPESEPIYVFLTSQSKGL,EKLQFIFTNIDPKNPESPFMFSLHLNEARDYE

Amino Acids from 3' Exons

RSAGKISSFKKKRITCNLLKKAKSRNWKYLQISRILRKNILGRRK,DQQAKAHSRKKGLVKIDCSKRQKAGIGSTDCKYPGSGRIFEEG,ISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKE