McDonnell Genome Institute

Washington University

CircRNA

chr2|168561191|168717978|+|CERS6|ENST00000305747.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9962

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

LGIFPLCILMK

Amino Acids from 5' Exons

HPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTRFCES,ILMKRDWKASPSNWTGMFEAFSAGFDKDAIRRSQARRGSVRA,SKEIGRPLQATGLGCSKHSALVSTKTQSGEAKHADEVLEH

Amino Acids from 3' Exons

AAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPL,LPKWQIMPSFRKCVISCLLCLPWFLSPHDWVYFLS,CQNGKLCQVSENVSPVCYVCRGFYHHTTGYISSL