McDonnell Genome Institute

Washington University

CircRNA

chr2|166903464|166903890|+|XIRP2|ENST00000409043.5

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

FSIALDELR

Amino Acids from 5' Exons

DNLDPSMFPMQKGSLNLLRQKWESCDYQRSECHPRDSHCTIFQPQESKLLAPEGEVVSAPQSLDPTSLPYSTGEEMWSSKPEEKDSVDKSNNTREYGRPEVLKEDSLSSRRRIERFSIALDELRSVFEAPKSGNKPAEYGGK,TTWTHPCSQCRRAPSTSGRNGNLVIIREVSVIPGTAIVQFSSLRKANCLRLKERYQHLNLWIPQVCPTVQGKRCGVRSRKRRILWTRVTTPGNMVGQKCRRIPAVGAGLNAFPLPLMSGVCLRLLRVETNQLSTVE,QPGPIHVPNAEGLPQPPEAEMGILLSEKVSSQGQPLYNFPASGKQIACARRGSISTSIFGSHKSALQYRGRDVEFEAGREGFCGQEQHQGIWSARSAEGGFPEQSAQDTLFHCPAEECVGSEWKQTSVRWK

Amino Acids from 3' Exons

DNLDPSMFPMQKGSLNLLRQKWESCDYQRSECHPRDSHCTIFQPQESKLLAPEGEVVSAPQSLDPTSLPYSTGEEMWSSKPEEKDSVDKSNNTREYGRPEVLKEDSLSSRRRIERFSIALDELRSVFEAPKSGNKPAEYGGK,TTWTHPCSQCRRAPSTSGRNGNLVIIREVSVIPGTAIVQFSSLRKANCLRLKERYQHLNLWIPQVCPTVQGKRCGVRSRKRRILWTRVTTPGNMVGQKCRRIPAVGAGLNAFPLPLMSGVCLRLLRVETNQLSTVE,QPGPIHVPNAEGLPQPPEAEMGILLSEKVSSQGQPLYNFPASGKQIACARRGSISTSIFGSHKSALQYRGRDVEFEAGREGFCGQEQHQGIWSARSAEGGFPEQSAQDTLFHCPAEECVGSEWKQTSVRWK