McDonnell Genome Institute

Washington University

CircRNA

chr2|166303089|166311806|-|SCN9A|ENST00000303354.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9554

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

SLLCEELK

Amino Acids from 5' Exons

ARQLGLSSQRSFLMSSLCSVVCLHLDYSCSWETSINVFEIHLKIMKHKAIPRVKKTLE,PEDNCRGFDPVSEEAFCHDPDCVLSECVCTNWTTAVHGKPEAMFSKFTKNIRKHNEYPRERRL,LKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFR

Amino Acids from 3' Exons

ASYVRSRGIKIYRMKRWQCCLPQDLRALSISQNSLLPSLNNALLKENQRNPKKKRKMMMKKPQSQAVTWKLANSCPSSMGTFLPAWCQSPWRTWTPTMQTK,PLMGAEEELKYTGKDGNVASPRTSELCPFHKTVSCPHTTHCKKIKGTQRRKERRSPKAKQLGSWQTAALHLWGHSSRHGVRAPGGLGPLLCRQK,LLCEELKRNNIQDEKMAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLPFIYGDIPPGMVSEPLEDLDPYYADKK