McDonnell Genome Institute

Washington University

CircRNA

chr2|1660880|1663763|-|PXDN|ENST00000252804.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9191

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

8

Peptide

NTIGSASVSMVLSVNGSQLSVDRR

Amino Acids from 5' Exons

DGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVSMVLSVN,MGFRQKVENFTSALKDSPSMTLALQTQVAMSVWPGTPLGRPRAWCSVM,WGSGDRKWKISHQPRILDHQRWPCRRRSLVCGPEHHWVGLGEHGAQCE

Amino Acids from 3' Exons

GASSPWTGGTWSCHREHLESLVLPSTTRASTNARLSTSSAPRRSWPTLCSPE,EPALRGPAAPGPVIGNTNLWCCPPRPGPVRMPGCQHHRLPEGRGPPDCAAQ,SQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPR