McDonnell Genome Institute

Washington University

CircRNA

chr2|1643367|1644752|-|PXDN|ENST00000252804.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9845

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

HSTSTCFR

Amino Acids from 5' Exons

VVVEPWGVLPGPADSDQADVAGQDPMRQRGQHHPGAERRVQGGGVPSRLRQLRDPQGRPPGVAGLL,LWYENPGVFSPAQLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCE,CGMRTLGCSPRPSLRSSRRRWPGSYATTRTTSPGCRATCSGWRSSLTATAAVTRSPGTSGCGRTAVK

Amino Acids from 3' Exons

VVWLDTQHRPVSGARGGGPGAWQPAGPHPDVSSQHTVQAPARWGQ,LYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGD,CMARHSTSTCFRRSWWRTWCLAAGWAPPCVFSAHSSSACEMGT