McDonnell Genome Institute

Washington University

CircRNA

chr2|159955198|160042198|-|PLA2R1|ENST00000283243.11

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.987

81

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AMGLFVK

Amino Acids from 5' Exons

IPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQ,FQVTIPLKFRNTFLSVPYSQVILIFISLENGILKTVERKAMGLFVKKCK,SKSQYHSSETHSSLCLTLKSFSFHWKMVFRLWKGRLWVCLKNA

Amino Acids from 3' Exons

ICIQSKGTPTGCRVCFPSSITISGIMNVPVKVGKMTYCGVPRQAVMKEMKSGDFALIP,FAYNQREHPRDAVYVSLPVPSVASMYPRSGRLTVVCHDKPLKRKVGILPS,LHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDP