McDonnell Genome Institute

Washington University

CircRNA

chr2|159806972|159810675|-|LY75-CD302|ENST00000504764.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9638

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

LNVNMVLEELSAK

Amino Acids from 5' Exons

TSLGVGMDQKHLSNGKIKVRVVLEDVACLQMKLGKKLNVNMVLEELSAKCLW,PVLELVRWIRSDICQMGKKEWCWKMHVDSFKNLEKSMTWFWKSCLQSAS,QSWSWLDGSEVTFVKWENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPL

Amino Acids from 3' Exons

LKSCPVLHIHQDVQQQKRMGHGGSSTRVTVTSLIRHCTVFQRPKNCVQNM,KAVPSYIFIKMSSSKREWVTVDPVQGSLLQVSGIAQFFRGQKIVFKT,KKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAKKLCSKH