McDonnell Genome Institute

Washington University

CircRNA

chr2|159395768|159433363|-|BAZ2B|ENST00000392782.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9211

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

12

Peptide

AEEQYKQAFPSQLK

Amino Acids from 5' Exons

ERERRRQHMMLMKAMEARKKAE,NESEGDNTCLKLWKLVKKQ,TRAKATTHDAYESYGSSKSR

Amino Acids from 3' Exons

EQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTSGRRTPGNQTPVMPSASPILHSQGKEKAVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPSSKDSEDSNEDEEEDDEEEDEEDDEDDESDDSQS,NNINRHSHHSRNKSHRRARRLLQLCQIQKQPLVHQHIQNKHKTTTQIHSQMHFVITNQMELFKVSFKKLLHLLPKLKCRARLMKTLLLQVAPLFPHLIVQVGEEPLAIRHLCPLPLPSCIVKGRKKQLAIMTQKHSITPILQNLWNNSEEQIQTFPVVKILKIQMRMKRKMMKKKMRKMMKMMNLMTANQ,TITGIPITVKETRVIEEPEEGYCSFVKSKSNLFTSTSKTNIRKQPPKSILDKCTFRSPTKWSYSKCHSRSSSSTYYQNNAEQDKHCCCKHPFFLTCKSEYKWEKNPWQSDTCNALCLSHPASREGKSSQCKPSKNTASLPSCKIFSGTIQRNRFRHSQRFRFKGRGRRRRGRRIQPI