McDonnell Genome Institute

Washington University

CircRNA

chr2|159248371|159279945|-|WDSUB1|ENST00000358147.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9341

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

DPVIASDVVVLK

Amino Acids from 5' Exons

NLDCVVKCGKLKSSGPRLNPFLQEFLMNLYVQLENLKIRSSHQ,ISRTASAEENRAQDQGIPFFRNSIYMSNNRTYERSGHRI,SLGLRSKVLRKIEELRTKVKSLSSGIPDEFICPITRELMKDPVIAS

Amino Acids from 3' Exons

MWCRWLLGGMCIFSWKLLCHWLLMWFNSVGNEVSAKSTSWNYLLRFFFTASF,CGSVKDGSLAACAFSPNGSFFVTGSSCGDLTVWDDKMRCLHSEKAHDLGITCCDFSSQPVS,VVVLKMAPWRHVHFLLMEASLSLAPHVVIQCGMIKGVCIVKKHMILELPAAIFLHSQFL