McDonnell Genome Institute

Washington University

CircRNA

chr2|158533179|158642699|+|PKP4|ENST00000389757.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9828

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

4

Peptide

ELVTGGMPAPEQASLVEEGQPQTR

Amino Acids from 5' Exons

EECQLLSRPHWWRRGNHRPARKLPPLAQAWNPRPQPPLFHPRS,RNASSAGLIGGGGATTDPPGSCLHWPRHGTRDHSHHYSSIREGA,GMPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQ

Amino Acids from 3' Exons

VCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSIDAEVRELVT,CVGGESSIWLTFWTTEFWKFRRMLVVPFETSFLASLQMKIKQRMLVGYLPCCDCENLLMQKGSLLQ,VVRGNQASGPSGPQSFGSSEECLWCPSKPRFWQVYRKNSNEECWWDTCLVATVEKIYCRSKGACY