McDonnell Genome Institute

Washington University

CircRNA

chr2|15461200|15504213|-|NBAS|ENST00000281513.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

LGTEDTGIIK

Amino Acids from 5' Exons

ESNVQALEILFTYHGSDLLPHRLAILSNFPETTSPHEYSVLLPEA,KVMYKPWKFCLLTMVPTCFLIALQFCPTFQRPLLHMNILFCCPKL,KCTSPGNSVYLPWFRPASSSPCNSVQLSRDHFSTIFCFAARSL

Amino Acids from 3' Exons

VPKTLGLLRMLSVKFYSRQGQEQ,YRRHWDYGCVSSFTVARDKN,TEDTGIIKDVKCQVLQSPGTRT