McDonnell Genome Institute

Washington University

CircRNA

chr2|15287072|15292766|-|NBAS|ENST00000281513.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.943

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

4

Peptide

LGSFYDPFGVPLHGQWADPK

Amino Acids from 5' Exons

NSRGKRLQHCYFSGTTLQCLPLGSFYDPFGVPLHGQW,TLEESVYSIAISLAQRYSVSRWEVFMTHLEFLFTDS,LRKASTALLFLWHNVTVSPAGKFLPIWSSSSRTV

Amino Acids from 3' Exons

ADPKELIKMVTRHVTRHEHEAWPEDLISLTKQLHCYNERLLDFTQAQILQGLRKGVDVQRFTADDQYKRETILGLA,LIPKNSRWSPGMLDMSTKPGLKTLFHPSSYTATMNVSWISLRRRSFRAFGRVWTCSGLLQMTSIKGKLSLVWQ,SQRTNQDGHQACDSTARSLARPYFTDQAVTLLQTSPGFHSGADPSGPSEGCGRAAVYCRPVKGNYPWSGR