McDonnell Genome Institute

Washington University

CircRNA

chr2|152147161|152150229|-|STAM2|ENST00000263904.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9567

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

EEGITFPPAGSQK

Amino Acids from 5' Exons

AHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQ,HILKYVKNNLWWSGQKNFRRTLSLVYLQLLNLKKKELLFLQQVL,TSSMKTEIFNGGVVRRISEGPSVSDICNYIYERRRNYFSSSRFS

Amino Acids from 3' Exons

KKPRMSTTLQKIGVLLWTYVTKLEVLLM,KSHEVQHYRRLESYYGHMQSWKYSW,KATNEYNTTEDWSLIMDICDKVGSTPN