McDonnell Genome Institute

Washington University

CircRNA

chr2|15186741|15238686|-|NBAS|ENST00000281513.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9917

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

QMLPAELSVEAR

Amino Acids from 5' Exons

HNQSMGETSYSDANQMYDGEQGRIGESFENVSLFVHQADAACR,ITNNPWVRLATVMLTRCTMENKEGLGNEVLKMCRSLYNTKQMLPAE,PIIHGDLQCPDVRWRTRKDWGMKFKCVALCITPSRCCLQ

Amino Acids from 3' Exons

LSVEARKEMTRKAIKTVKHFIEKPRKRNSEDEAQEAKDSKVTYADTLNHLEKSLAHLETLSHSFILSLKNSEQ,CLWKPVKRLERLLRQSNILLRSQGKETQKTKLKKLRILKLPMQILIIWRNHLPTWKPATASSFLRIVS,VCGSPRDDKGYDSQTFYEAKEKKLRRRSSRSGFSYLCRYFESSGEITCPPGNPEPQLHPFSEEA