McDonnell Genome Institute

Washington University

CircRNA

chr2|151575694|151600753|-|NEB|ENST00000397345.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LVWAANVLK

Amino Acids from 5' Exons

PKYREVWDKDKTSIHIMPDTPEINLARANALNVSN,QSTERFGTRIKLQYTCQILQKLISLEQMLLMA,KVQRGLGQGNFNTHNARYSRNSRSKCSCEQ

Amino Acids from 3' Exons

YLYKTAYEKQKGHYIGCRSAKEDPKLVWAANVLKMQNDRLYKKAYNDHKAKISIPVDMVSISAAKEGQALASDVDYRHYLHHWSCFPDQNDVIQARKAYDLQSD,ICTKLLMRNRKAITLAVAAPRKTLNWFGQQMCRCRMTGCTKRPTTTTKPRSPSLWTWCPSALPKKVRHWQVMWTIAITCTTGLAFPTRMMSKPGKPTTYRA,SVQNCLETERPLHWLSQRQGRPTGLGSKCVEDAEQAVQKGLQRPQSQDLHPCGHGVHQRCQRRSGTGKCGLSPLPAPLVLLSRPECDPSQESLRPTER