McDonnell Genome Institute

Washington University

CircRNA

chr2|151457760|151474072|+|RIF1|ENST00000243326.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9072

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

DLSQLEK

Amino Acids from 5' Exons

LEKLLGEIIACLQFSYTGTYDSELLEQLSPLLCIIFLHKNKQIRKQSAQFWNATFAKVMMLVYPEEL,KSYWEKLLLVCNSATPELMIVNFLNNSPHYYAYFCTRINRFENRVLSSGMPLLPKCWFILKS,RKATGRNYCLSAIQLHRNLTSTTLPTIMHNISAQETDSKTECSVLECHFCQSDDVGLSRVK

Amino Acids from 3' Exons

VKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLVS,RLVDKRFQFLIFLKKQMEKINLCHLMKKDLSQ,EDSWTRRDSSFYFKNSKWNRKIFVTRKTCL