McDonnell Genome Institute

Washington University

CircRNA

chr2|148922136|148950462|+|KIF5C|ENST00000435030.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9103

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

STLMFGQSK

Amino Acids from 5' Exons

QGKPYVFDRVLPPNTTQEQVYNACAKQIVK,KGSHMSSTECYLPTRPKSRFTMHVRSKLSK,REAICLRQSATSQHDPRAGLQCMCEANCQ

Amino Acids from 3' Exons

KTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQ,KHMCHTGTARLGFFRTLWVGTAEPPSSFAVLLLSSMRLRPSPHCSDR,NTCAIPGQQDDSDSSGLFGWELQNHHRHLLFSFCLQGDQVHTDVRTE