McDonnell Genome Institute

Washington University

CircRNA

chr2|147943435|147948224|-|ORC4|ENST00000264169.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9454

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

8

Peptide

LRSLHMLLDILELLEK

Amino Acids from 5' Exons

YLSEDRSVQEVLQKHFNISKNLRSLHMLL,ISQKIEVCKKYYRSISISAKTCGHYTCY,SLRRKCARSTTEAFQYQQKPAVITHAI

Amino Acids from 3' Exons

DILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQ,IFWNSKKESQDFLTGRYTIHLVFHSMLKYLKNSYLYLQSFQTRFLLRSGMKMF,YFGTLRKKSEVKIFSPADTLNEFIWFSTVCNIRTVISTCRVSRQGFCEVEKCS