McDonnell Genome Institute

Washington University

CircRNA

chr2|141058882|141062273|-|LRP1B|ENST00000389484.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LGNPNLSK

Amino Acids from 5' Exons

VRHLYGITVFEDYLYATNSDNYNIVRINRFNGTDIHSLIKIENAWGIRIYQKRTQPT,LDIFMVLCLKIICMQPILITTISGTDLMGLIFTHLKLRMLGESEFIKKELNQQ,TSLWYNCVRLFVCNQFLQYRKDKPIWDYSLINNECLGNPNLSKKNSTN

Amino Acids from 3' Exons

KTFLYLRECRQSGEMHGWDEPNKDNFKDRAASCTGTRPSQQIGLLGRSLLGLCGSSGLSRKKTHCHSRQT,KLFFTDYGNVAKVERCDMDGMNRTRIIDSKTEQPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHTVIQGRQ,NFSLLTTGMSPKWRDVTWMGTEQGLIQRQSSQLHWHTSTNWFTGIFTWTMWEWTIKEKIDTLSFKAD