McDonnell Genome Institute

Washington University

CircRNA

chr2|135761817|135770735|+|UBXN4|ENST00000272638.13

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9348

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

SLVDAQIR

Amino Acids from 5' Exons

EEKVQAMPLPLRSLVDAQIRDLQRTSTSEWK,RRKCRPCHFLSGAWMLRSETCRGPQHPSGK,GESAGHATSSQEPSGCSDQRPAEDLNIRVE

Amino Acids from 3' Exons

REIKKEIERRKTGKEMLDYKRKQEEELTKRMLEERNREKAEDRAARERIKQQIAL,EKLRRKLRGEKLEKKCWIIKENKKKNQKECWRKETERKQKIGQLENVNSRLH,RNEGNEEKNWKRNVGLKKTRRRINKKNAGGKKQRESRRGSSRTYKTADCI