McDonnell Genome Institute

Washington University

CircRNA

chr2|135115215|135124246|+|RAB3GAP1|ENST00000264158.12

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.985

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

15

Peptide

LEFGKLPFGACEDPISQVPLFVQIHHK

Amino Acids from 5' Exons

SGATLCANSPQMAKNVCRRMSRSWCTNFRNGSSKSAKSVHSLIRSAGYLQIKD,QVPLFVQIHHKWRRMYVGECQGPGVRTDFEMVHLRKVPNQYTHLSGLLDIFKSKI,RCHSLCKFTTNGEECMENVKVLVYELISKWFILEKCQISTLTYQVCWISSNQR

Amino Acids from 3' Exons

TMPLEEKLEAWSLASYHLVPAKILL,HRCPCRRRSWRLGVWQVTIWCLRRSY,IDALVGGEVGGLEFGKLPFGACEDPI