McDonnell Genome Institute

Washington University

CircRNA

chr2|128107937|128182290|+|UGGT1|ENST00000259253.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9689

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

3

Peptide

LFLLSCNIGGCISVSVTPPAEFV

Amino Acids from 5' Exons

VPIIPTIMQYWRLHFSFCHPSSRICLNFVCPFVLTQLQSKPSS,YRLFLLSCNIGGCISVSVTPPAEFVILSVPSFLLSYNPSLPA,TDYSYYHAILEAAFQFLSPLQQNLFKFCLSLRSYSATIQAFQQ

Amino Acids from 3' Exons

IVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHI,LYEQIKSEISIWMVLLMVTLLSVTAEEKWTATGSGSQGTGPVIPGESIIS,CTNRSERVKRFQFGWCSLWLHSFLQPKRNGRLQVLEVRVLGQSFSRAKVSYQ