McDonnell Genome Institute

Washington University

CircRNA

chr2|127713582|127771004|-|WDR33|ENST00000322313.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9688

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

EESILEGK

Amino Acids from 5' Exons

VTPAALQTITWARCQRGGMSRAAGLSMGPRGGLSGVARTAGVPLIGVALTQTSPMTSADQMTSTLTSALATGYVNLRGEEDLYRKKRSGGEGALGLRFPLITGNSARGMAGVQPEALRGHGKAAGPEMNVSPGIPRTHVFEGAEKK,LPRPSKPSHGPDVREAAAERRAAWAREGAFPGWPGLQGSPAWPSPRLPRLQQTRLPPQALWPPVTIGARRTFTARREVEARGPWASVSPSQGIQRGGWPGCSPRPSGGMGRPQARRTFPPGSRGPTFSRAQRRK,DSRGPPNHHMGPMSERRHEQSGGPEHGPERGPFRGGQDCRGPPDRRGPHPDFPDDFSRPDDFHPDKRFGHRLREFEGRGGPLPQEEKWRRGGPGPPFPPDHREFSEGDGRGAARGPPGAWEGRRPGDERFPRDPEDPRFRGRREE

Amino Acids from 3' Exons

YPRRKTSPWLQKLVLLLVFSICQGSSTRHLDSCFISDLILHNSKQCNSLLLMENEEKLTEKPTTIHLLSIW,ILEGKHHHGYRNWFSSSFFPYAKVPAPGTSTAVLATFCTTASNATAYFWKTNEKSCEPKNHRLQSICNVFG,SKENITMATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLE