McDonnell Genome Institute

Washington University

CircRNA

chr2|124417442|124434687|+|CNTNAP5|ENST00000431078.1

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.935

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

9

Peptide

GGSPYTSIWTFAGNMNADSVVHHK

Amino Acids from 5' Exons

TFAGNMNADSVVHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSY,PLQETMLTAWCTTSYCTQEPDLFALCPWNGIPVGRLAESRSTDVPI,LCRKHECQRGAPQAIALSESPICSLCAPGMESQWEDWHESRGLRMFL

Amino Acids from 3' Exons

NQMLLTLMAEAHFCTGSIRSVLSKMSPSSRACKEMGSCSMEKVSVETTSPWNSRRGGSPYTSIW,IRCCLWPKLTSVQVQSEVDEYSQRCDLPEVQEHARRWGPVPWRRSAWRPHHLGTPEGEARPTPQF,SDVADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQKGRLALHLNL