McDonnell Genome Institute

Washington University

CircRNA

chr2|121407470|121407715|-|CLASP1|ENST00000263710.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9178

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

RASGPAELTEEPK

Amino Acids from 5' Exons

KKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTL,RSLGGDMSRMGCILTMMPTVMPQVFALSAHMAPGMVAFPIICGRLRMQKFSTTVLVQTGQKGKKGFWACRTYRAKEH,EACEEEIAVWDVFRCQQCLKCLLALIWLQEWWHSPLSAADGCSRSSQPLCFKLVRKERRASGPAELTEEPKNTE

Amino Acids from 3' Exons

KKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTL,RSLGGDMSRMGCILTMMPTVMPQVFALSAHMAPGMVAFPIICGRLRMQKFSTTVLVQTGQKGKKGFWACRTYRAKEH,EACEEEIAVWDVFRCQQCLKCLLALIWLQEWWHSPLSAADGCSRSSQPLCFKLVRKERRASGPAELTEEPKNTE