McDonnell Genome Institute

Washington University

CircRNA

chr2|121363171|121469960|-|CLASP1|ENST00000263710.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9345

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

EIKISTMK

Amino Acids from 5' Exons

HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKE,IQFEHWREFGKFEINQQDLKTTPSRLRLWKPTKTPIR,FNSSTGVKSFEGNSEKSTSKIKLRRADDYEDSGSPQRLPG

Amino Acids from 3' Exons

IKISTMKILWMVTDLPLLVLHHPRLHQVLGETLEWEPPAGLVHPPLDPSLQ,KFRRRFCGWQTFLCFYIIQGSTKFSEKRWNGNHPPAWFIHPWIQVF,KNFDDEDSVDGNRPSSASSTSSKAPPSSRRNVGMGTTRRLGSSTLGSKSS