McDonnell Genome Institute

Washington University

CircRNA

chr2|120019076|120075753|+|EPB41L5|ENST00000263713.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9674

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

LAAYNLQVTK

Amino Acids from 5' Exons

QKCVSSVEHGVGLCVNMQRRNDSEKHNAPPHIFLQLEILSPSSRVGCPFWMVLMLVWTC,DKNAEFLPNTRASVYATCREGTTPRSTTRRHTYSCSWRFVHHHVSGVPSGWYCCGLA,TKMLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP

Amino Acids from 3' Exons

IRLSLYSSAIGSLSA,LDCPFDTAVQLAAYNLQ,TVPLIQQCNWQLIICK