McDonnell Genome Institute

Washington University

CircRNA

chr2|113731583|113742879|-|SLC35F5|ENST00000245680.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9038

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

2

Peptide

LVNLAGSEKPAGRDTVAPK

Amino Acids from 5' Exons

HWRRCTGKPGRVKTCWKRHS,IGGVVLVNLAGSEKPAGRDTV,LEALYWTWQGLKNLLEETQ

Amino Acids from 3' Exons

PPKSLVGSVISWRFDSFRQVMHWKQSCLACHILKNKNPYKLWGNLLQLKRKLAFFFAL,PQKVSCEVQYHGDSTASVKSCIGSKVVSHVISCERTRIHTENCGETYCNSSSENLFFLLC,PKKSRVRFSNIMEIRQLPSSHALEAKLSRMSYPVKEQESILKTVGKLTATQVAKISFFFCFV