McDonnell Genome Institute

Washington University

CircRNA

chr2|113192379|113193650|+|PSD4|ENST00000245796.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9785

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

MDSENLR

Amino Acids from 5' Exons

ESEDTDELFLASWEPYAPSTVPRGRPETTSWRQASWRQEQQGSLELGLTPLSPGGLPEVSGCLPAEE,ENLRTPMNSSWLPGSPMPQAQSPEEGQRPPAGDKLANGVRNNKVAWNLASRLYRLEGFRKSEVAAYLQK,RIGHRTLLGFLGALCPKHSPQRKARDHQLETSLMASGTTRPGTWPHASIAWRASGSLKWLPTCRR

Amino Acids from 3' Exons

ILYTPHVQSCCLTRTCMD,FCTHLDMCNHAAHGPAWT,SVHTLTCAIMLLNTDLHGQ