McDonnell Genome Institute

Washington University

CircRNA

chr2|11200956|11201143|-|ROCK2|ENST00000315872.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9518

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

13

Peptide

MLQLLLDSLAAQLEITLTK

Amino Acids from 5' Exons

GLFGCPTGDHLDQSRFATGSFNCRTIFFGKREDHERAGDQRDDGTQTGTYGKRCYNCF,DSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIAS,TLWLPNWRSPPKQILSNWLVQLLKNNILIWKKRRSKSWRSKRWLDTNRNLRKKMLQLL

Amino Acids from 3' Exons

GLFGCPTGDHLDQSRFATGSFNCRTIFFGKREDHERAGDQRDDGTQTGTYGKRCYNCF,DSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIAS,TLWLPNWRSPPKQILSNWLVQLLKNNILIWKKRRSKSWRSKRWLDTNRNLRKKMLQLL