McDonnell Genome Institute

Washington University

CircRNA

chr2|11197179|11207910|-|ROCK2|ENST00000315872.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9526

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

QMMGFQVR

Amino Acids from 5' Exons

QIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPGDAEADDGFP,KLKRARFELNCRHWTVKTVTLSSCGHNSKPCILVWIVPVAVDQGMLRQMMGFQ,NSREPDSNTADDIGQRQHAAAVTTPSLAYWSGFQYRQWTRGCGRWVS

Amino Acids from 3' Exons

VRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELR,LETHKSKKLRSAALHKMTRCKHNRLTHKCQKSSSKKITISWKKTWKNKMLNFE,KPDIKNRARNSEALPYTKPEDANTTGHTKNVRKAVKARKPSHGNENELGKTKCTSK