McDonnell Genome Institute

Washington University

CircRNA

chr2|111123732|111144520|+|BCL2L11|ENST00000619294.4

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

LGLETAPSPR

Amino Acids from 5' Exons

KKRPNGKATFCKFVPRRTIAACGEASPAQTWGPYLPTDRATRSRQSRRRGQLPPRQPSGPAGPTCQPWPFCYQIPAFHLYEKILPAVSILQWVFLFHRQEPSTHELQINTNPKSSLPGLQPLSQCN,KKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM,KKTKWQSNLLMVLSVTEKVDNCSLRRGLPSSDLGPLPPYRQSHKVILKAITEVKGTAAPTAALRARWPHLPALALLLPDPRFSSLEDPPCCLDPPVGISLLTQTGAQHPVVTNQHKPQVLLARPSTTISVQW

Amino Acids from 3' Exons

LTGTRNSSITQ,LGLETAPSP,NWDKQLHHP