McDonnell Genome Institute

Washington University

CircRNA

chr2|109567814|109585838|-|SEPT10|ENST00000356688.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9158

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

VNAAMNK

Amino Acids from 5' Exons

VNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMN,TLYQLPKQIRFLKLNYRSLRSSSVNWSAMASRYTSSQRMMTLLLRSTLQ,KHYTSDCQSRYGFNITEVDQAHEIGQQWRPDIPVPNGHYCGQRCNE

Amino Acids from 3' Exons

KRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCV,KEKTFVRLCLAMLVLRVCLISWTDPFSKVSALIFSVW,KRKHSFVDYVWPCWFEFASAGEQIHSARFLLYSLC