McDonnell Genome Institute

Washington University

CircRNA

chr2|108788851|108856970|+|CCDC138|ENST00000295124.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9714

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

17

Peptide

GLLSNVIDSLLQMTVESSDLDIYSGDK

Amino Acids from 5' Exons

VIWISTLEIKLVHRNILMKASIVEHHWAAYSSTMI,FGYLLWRSWFIVKIFKQALNTIGQLIQARKCEL,DLDIYSGDKVGSSLKYSDESKHCRTPLGSLFKHVNVN

Amino Acids from 3' Exons

LITWLRHLILFVWTRQKKEKPCFWSIRLFQYVIEYPVKDSCLMLLIVCSRRWNL,LPGSGIFSLFGLEDRRRKNLVFGVSGCSSNIKSSKNIQRTPVCYFAPDDGGI,DYLAQAFDSLCLDLKTEEGKTLFLEYQAVPVILSHLRISSKGLLSNVIDSLLQMTVES