McDonnell Genome Institute

Washington University

CircRNA

chr2|108001896|108006202|+|SLC5A7|ENST00000264047.2

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9956

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

GWELLTHLK

Amino Acids from 5' Exons

WISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSWLDSFLLL,GSASPLHCHILQSQTSGSLLCMPNTKSRGWELLTHLKSTLGLIVFCC,DQRPLCIVTSCSRRHRVHCCACQIPKAVAGNCLISLLLAFSVV

Amino Acids from 3' Exons

MLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGAST,CWVESHGKHTFRGFSLLPQPPMLKCCPSWQLSGAWWPSQPYSLGPLEHQQ,AGWNPMASILSEGSLFFLSHLCSSAVLPGSFRVPGDGHPSHTHWGHWSIN