McDonnell Genome Institute

Washington University

CircRNA

chr2|105881327|105882049|+|NCK2|ENST00000233154.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9017

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

DSESSASARR

Amino Acids from 5' Exons

ASARRAGRPARGMRPPRPARTPSTPPMAAAPTASTTSTSRPSSSSPMWPSGRMSCPWRGRASPSWRSAATVGGGAATTGRSAGSPPTTSWRRWTRRLRSPQASACARAPRAMARAPACCMWSRRCTPSAQSPRRSSTSRRGRPWRLRSRRTTPSGGNAKMPGARWASSPKTTWWSSVTGLPCTLRTPHRATPGPRPAGASRAESGTTGTRGTRPSAPSTSGAWRATSSLGTASP,PRQDAQEDQRAGCVPHAQHGRRVPRQWQRRRPHLRPQHPGLRQVRLCGRAGGVVPGEGVARHRHGEVQRRLVAGQLQRADRLVPLQLRLGGGGRGGCGVPKLPEPAQGRLAEQWPGLPRAACGPDAVPLQLSHRGGAQLREGGDHGGDEAGERPRVVEMQKCPGPGGPRPQKLRGGPQRACPAPCARPTDKLHRALVQRALRGQRVVLRERDAAPGRVRPQRAGRGGRLPHGQRVL,LGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSESS

Amino Acids from 3' Exons

ASARRAGRPARGMRPPRPARTPSTPPMAAAPTASTTSTSRPSSSSPMWPSGRMSCPWRGRASPSWRSAATVGGGAATTGRSAGSPPTTSWRRWTRRLRSPQASACARAPRAMARAPACCMWSRRCTPSAQSPRRSSTSRRGRPWRLRSRRTTPSGGNAKMPGARWASSPKTTWWSSVTGLPCTLRTPHRATPGPRPAGASRAESGTTGTRGTRPSAPSTSGAWRATSSLGTASP,PRQDAQEDQRAGCVPHAQHGRRVPRQWQRRRPHLRPQHPGLRQVRLCGRAGGVVPGEGVARHRHGEVQRRLVAGQLQRADRLVPLQLRLGGGGRGGCGVPKLPEPAQGRLAEQWPGLPRAACGPDAVPLQLSHRGGAQLREGGDHGGDEAGERPRVVEMQKCPGPGGPRPQKLRGGPQRACPAPCARPTDKLHRALVQRALRGQRVVLRERDAAPGRVRPQRAGRGGRLPHGQRVL,LGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSESS