McDonnell Genome Institute

Washington University

CircRNA

chr2|102008514|102009826|+|IL1R2|ENST00000332549.7

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9631

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LSGAMLR

Amino Acids from 5' Exons

ATCCWVSVLHFPCPLEVVRSNVALVRVGNGSFCLHPSACGTH,PRAAGSQSSTSRVLWKLSGAMLRLYVLVMGVSAFTLQPAAHT,HVLLGLSPPLPVSSGSCQEQCCACTCWWEFLPSPFSLRHTQ

Amino Acids from 3' Exons

GLPEAAGFVGGITSGSSGWKGSLPGAPRCPTGCGPLSAPASTHGIKMTLLGRSQEKKRHGCGPRTVLCGFCQPCRRTLAPTSALL,GCQKLPVSWEALQAGVQAGRGACSPEVPPGALLVVGLCQPPHQPDMAKLCDGPRRRRDTDVGPGRCSVASASLAGGLWHLRLHY,AARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTT