McDonnell Genome Institute

Washington University

CircRNA

chr2|101863820|101870415|+|MAP4K4|ENST00000324219.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

SEVLSQSSDSK

Amino Acids from 5' Exons

VQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPR,YSGPTWHLSRTMFPLSRDPIPSVTLLPNLHTTIFVLRTHVHLPAVRCSVRALTLSQRRLTLPKRLGLDQTVTRCLQ,TVVPPGISQEQCFPCLAIPFLQPFSQICTPPSSFSGPMSTFPQGAQSELLVRGAPYPKGLVIRQRGASK

Amino Acids from 3' Exons

VISEFEQWNGICENHDCPCRKAGHDPIQGGHSNRPP,SSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQ,HLIAMVKRNLKPLSMMMKVSRPPHPRRALSSA