McDonnell Genome Institute

Washington University

CircRNA

chr2|101823927|101844311|+|MAP4K4|ENST00000302217.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9848

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LEEDEEEEIK

Amino Acids from 5' Exons

DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLW,MKRKKSNWRICRNTLITETLQHIMVLSSKRALQDMMTNS,RGRNQTGDKYAKEILSSQKHCNILWCFHQKEPSRTPTL

Amino Acids from 3' Exons

FHCERAWVYSSPRFPETAAGEQGTFRGSSETTVTTGATAPGAGRIKATAGRETEADAAERTEATARR,SIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEE,PLTCLVSLLFAEISDCSRRTRNVPRLFGDNSYYRSNSSGSRKNIKGNCWQRDRSGLSSRKNRGDGK