McDonnell Genome Institute

Washington University

CircRNA

chr2|101021680|101022521|-|TBC1D8|ENST00000376840.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

LNYYTGFISLQR

Amino Acids from 5' Exons

ILCIMEKMRRLNYYTGFISLQ,YYVWRNEEDTIIQASYPS,IMYNGEMNEKIKLLYRLHIPP

Amino Acids from 3' Exons

REHMMSCYWEQPRPMASRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGAHTEILAERTFRLLDDNMDQLIEFKAFVSCL,ENIAVTGSSPGPWPHATTPAGPMLSSTAMPGSLHTCFSSRPGPAGPTRRSSPKGRSGSWMTTWTSSSSSKRLAAS,RTYDELLLGAAQAHGLTPRPQPALCAVPHRCPAVCTPVSASLALDLRGPHGDPRRKDVQALGQHGPAHRVQSVCELP