McDonnell Genome Institute

Washington University

CircRNA

chr19|8910088|8914322|-|MUC16|ENST00000397910.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LTSLRPEK

Amino Acids from 5' Exons

LGPIFKNTSVGPLYSGCRLTSL,LVPYSRTPVLALCTLAADPLS,WSHIQEHQCWPSVLWLQTDLSQ

Amino Acids from 3' Exons

ARERWGSHWSGCHLHPPPPQKPWTQQGAAVLGAKQTDQHRAGPLHPGQEQSLCQ,PEKDGAATGVDAICTHRLDPKSPGLNREQLYWELSKLTNDIEELGPYTLDRNSLYVN,PRKMGQPLEWMPSAPTALTPKALDSTGSSCTGSANPMTLKSWAPTPWTGTVSMSM