McDonnell Genome Institute

Washington University

CircRNA

chr19|875243|877180|-|MED16|ENST00000312090.10

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9523

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

ITDVAER

Amino Acids from 5' Exons

VLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDV,SSPPGSWPRPRSASCRPARPACATTTPSSSSSPSAPPSRCCAPTFSTRLTRAPATGPRSAPRSPTS,PLHPDPGHEGLALQAVALHGDPRVRLPHQALPHRHQLHPEVAAAPPLSQHAQEPRRPADRDLHQDHRR

Amino Acids from 3' Exons

LSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQ,ACSASHLPWATRWRWGWRCGTCSSCWSTAWPATTGGTSCCTCSPVWYRAWWRSCTRSTRARPLPCS,ERAPPLTFHGPPAGGGAGAAAPALPAGVLHGDRLRLVGHPAARAAQYGTEPGGEAARGVHAPDRCPAA