McDonnell Genome Institute

Washington University

CircRNA

chr19|8553138|8553437|-|MYO1F|ENST00000594774.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9586

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

9

Peptide

LCATTIPAAFGESGAGK

Amino Acids from 5' Exons

WREWSWEDSGSQIYHGLHLQGVWRRREGPGETRKTEGAGSPSPAWCSPTHLHSCLSLTSSHSTCLCPSTSKISSCSPTRCSRPSATPRLCATTIPAA,GESGAGKTVAAKYIMGYISKVSGGGEKVQVRRGKQKDKLGRPHLHGSAAPPICTPASVLLPTPPASAPARQRYHPAVQPAARGLRQRQDCAQQQFQPL,ERVELGRQWQPNISWATSPRCLAEARRSRDEENRRISWVALTCMVVQPHPSALLPQSDFFPLHLPLPQHVKDIILQSNPLLEAFGNAKTVRNNNSSRF

Amino Acids from 3' Exons

WREWSWEDSGSQIYHGLHLQGVWRRREGPGETRKTEGAGSPSPAWCSPTHLHSCLSLTSSHSTCLCPSTSKISSCSPTRCSRPSATPRLCATTIPAA,GESGAGKTVAAKYIMGYISKVSGGGEKVQVRRGKQKDKLGRPHLHGSAAPPICTPASVLLPTPPASAPARQRYHPAVQPAARGLRQRQDCAQQQFQPL,ERVELGRQWQPNISWATSPRCLAEARRSRDEENRRISWVALTCMVVQPHPSALLPQSDFFPLHLPLPQHVKDIILQSNPLLEAFGNAKTVRNNNSSRF