McDonnell Genome Institute

Washington University

CircRNA

chr19|8551739|8553228|-|MYO1F|ENST00000338257.12

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

SDFGETLHVK

Amino Acids from 5' Exons

LLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETL,CWKGPPRSKGRTWASHRTTITTSTNRTPTRWTARTTEATLVRL,AGRGLPGAKAEPGPHDTGLLLLPQPIGHLPGGRHGRQKRLWDS

Amino Acids from 3' Exons

HVKDIILQSNPLLEAFGNAKTVRNNNSSRF,TSKISSCSPTRCSRPSATPRLCATTIPAA,RQRYHPAVQPAARGLRQRQDCAQQQFQPL