McDonnell Genome Institute

Washington University

CircRNA

chr19|805012|805187|+|PTBP1|ENST00000349038.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9948

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

24

Peptide

DYTRPDLPSGDSQPSLDQTMAAAFVAGRAEHLQR

Amino Acids from 5' Exons

SLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAF,RWTGRTSTTPAARCASTFPSSPASTSSTTMTRAVTTHAQTCLPGTASPRWTRPWPRPS,AGRAEHLQRLLHAAHRLFQAHQPQRQVQQQEPLHTPRPAFRGQPALAGPDHGRGL

Amino Acids from 3' Exons

SLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAF,RWTGRTSTTPAARCASTFPSSPASTSSTTMTRAVTTHAQTCLPGTASPRWTRPWPRPS,AGRAEHLQRLLHAAHRLFQAHQPQRQVQQQEPLHTPRPAFRGQPALAGPDHGRGL